• Product NameRecombinant human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:4-99aa
  Sequence Info:Partial
• Alternative Names    Complex I-B8 ;CI-B8NADH-ubiquinone oxidoreductase B8 subunit
• Accession No. O43678
• UniprotO43678
• Gene ID4695;
• Calculated MW 37.6 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence AAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits.Ton C., Hwang D.M., Dempsey A.A., Liew C.-C.Biochem. Biophys. Res. Commun. 241:589-594(1997)
Research Topic:Transport

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting